PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla001506
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family TCP
Protein Properties Length: 285aa    MW: 30795.3 Da    PI: 9.1123
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla001506genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP121.78.6e-3857142288
        TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                a+k+++++++h kv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tg+++++as+  +++ +s ++++ss 
  Cla001506  57 APKRTSNKDRHKKVDGRGRRIRMPALCAARVFQLTRELGHKTDGETIQWLLQQAEPSIIAATGSGTIPASAL-HVAGVSLSDHDSSV 142
                789******************************************************************777.33333333333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036348.2E-3261156IPR005333Transcription factor, TCP
PROSITE profilePS5136927.38163117IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MADHNNNNSN NNNKPSVAAS STPITPLPPS SDIKDFSLII ANKDQNKKQQ QQQQQLAPKR  60
TSNKDRHKKV DGRGRRIRMP ALCAARVFQL TRELGHKTDG ETIQWLLQQA EPSIIAATGS  120
GTIPASALHV AGVSLSDHDS SVSVSATLTP KIDAVPRSNW AMMGANLNRS HMATPGFWPS  180
LGGIGTGFVS ENSGSIMPKF GFHGFEFQGM NLGSVNFPTI IGNQHQQIPG LELGLSQDGN  240
NLRGMLNPPS YSQIYHQIGQ NRESSAAAPL EQDQAPDKDD SQESR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008459878.11e-159PREDICTED: transcription factor TCP20-like
SwissprotQ9LSD57e-74TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A0A0KC881e-156A0A0A0KC88_CUCSA; Uncharacterized protein
STRINGPOPTR_0017s09820.11e-80(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF33393269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.15e-65TCP family protein